PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000320566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 618aa    MW: 69631.9 Da    PI: 9.2891
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000320566genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.43.8e-554755991129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    +ppGfrFhPtdeelv++yL+kkv++++++l +vik+vd+yk+ePwdL+   ++e+++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s k
  MDP0000320566 475 VPPGFRFHPTDEELVDYYLRKKVTSRRIDL-DVIKDVDLYKIEPWDLQ--GTEEQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYS-K 566
                    69****************************.9***************8..345778**************************************.8 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                    + l+g++ktLvfykgrap+g+k+dW+mheyrle
  MDP0000320566 567 HDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 599
                    899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM008562.4E-186126IPR006501Pectinesterase inhibitor domain
CDDcd157982.86E-247126No hitNo description
Gene3DG3DSA:1.20.140.401.5E-2110128IPR006501Pectinesterase inhibitor domain
SuperFamilySSF1011486.28E-2412128IPR006501Pectinesterase inhibitor domain
TIGRFAMsTIGR016143.0E-1714128IPR006501Pectinesterase inhibitor domain
PfamPF040436.0E-1817126IPR006501Pectinesterase inhibitor domain
Gene3DG3DSA:2.160.20.107.8E-121157464IPR012334Pectin lyase fold
SuperFamilySSF511264.19E-114157461IPR011050Pectin lyase fold/virulence factor
PfamPF010952.9E-141162457IPR000070Pectinesterase, catalytic
PROSITE patternPS008000188207IPR018040Pectinesterase, Tyr active site
PROSITE patternPS005030305314IPR033131Pectinesterase, Asp active site
SuperFamilySSF1019414.84E-56472604IPR003441NAC domain
PROSITE profilePS5100554.561475618IPR003441NAC domain
PfamPF023651.5E-28476598IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042545Biological Processcell wall modification
GO:0005618Cellular Componentcell wall
GO:0003677Molecular FunctionDNA binding
GO:0004857Molecular Functionenzyme inhibitor activity
GO:0030599Molecular Functionpectinesterase activity
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MTQDEKSLSI PKQLSNFKKL AVQVTLERAL KAQSHNKWLG QKCRNKKERA AWADCMSLYE  60
ETIKLLNQTI DPATKSTDYD TQTWLSTALT NLDTCRAGFV ELEVSDFVFP LMSNNVSKLI  120
SNTLSLWNSS NVSPVTXMYT EGYPSWVSPG DRKLLQSTPT ADVVVAQDGS GNYKTIKAAL  180
DAAAARGGSK RFVIHVKRGV YKENLEIKLK XIYLLGDGLR YTIITGSRSV VGGSTTFKSA  240
TVAVTGEGFI ARGITFRNTA GPENHQAVAL RSGADLSVFY RCGFEGYQDT LYTHSQRQFY  300
RECYVYGTVD FIFGNAAVVF QNCMIYARKP MSGQQNTITA QGRTDPNQNT GISIHDSRVM  360
AALDLESSVG SVKTFLGRPW KEYSRTVFMQ SFLDTLVDPA GWLQWSGDFA LKTLYYGEYK  420
NIGPGAPTTG RVKWGGYRII TSSSEASKFT VDNFIAGSSW TEDQKLDNME TFSHVPPGFR  480
FHPTDEELVD YYLRKKVTSR RIDLDVIKDV DLYKIEPWDL QGTEEQNDWY FFSHKDKKYP  540
TGTRTNRATA AGFWKATGRD KAIYSKHDLI GMRKTLVFYK GRAPNGQKSD WIMHEYRLET  600
DENGTPQARI XIAHILNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gq8_A1e-1271574603307PECTINESTERASE
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008377824.10.0PREDICTED: pectinesterase 2-like
SwissprotO048870.0PME2_CITSI; Pectinesterase 2
TrEMBLM5XII40.0M5XII4_PRUPE; Pectinesterase (Fragment)
STRINGPOPTR_0015s14740.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.14e-78NAC 007